TB-500
Also known as: Thymosin Beta-4, Tβ4
Studied in laboratory models for its role in actin regulation, cell migration, and tissue-repair pathways.
$45.50 per vial · sold in packs of 10
10–15 days delivery. Orders ship directly from our manufacturing partner. Allow 10–15 days for delivery. Shipments may be subject to customs clearance, which can affect delivery time.
| Packs | Discount | Per vial |
|---|---|---|
| 1–2 (10–20 vials) | — | $45.50 |
| 3+ (30+ vials) | −5% | $43.22 |
| 5+ (50+ vials) | −10% | $40.95 |
| 10+ (100+ vials) | −15% | $38.68 |
- COA issued by Janoshik Analytical
- HPLC + MS verified identity
- Discreet plain, tracked packaging
- Interac e-Transfer, Cryptocurrency, Alipay, Western Union
Specifications
| CAS number | 77591-33-4 |
|---|---|
| Molecular formula | C212H350N56O78S |
| Molecular weight | 4963.4 g/mol |
| Sequence / structure | Ac-LKKTETQ (active Thymosin beta-4 region; full Tβ4: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES) |
| Purity | ≥99% (HPLC) |
| Appearance | White lyophilized powder |
| Solubility | Soluble in bacteriostatic water / 0.9% NaCl |
| Storage | Lyophilized: -20°C, 24+ months. Reconstituted: 2-8°C, use within 4 weeks. |
| Available sizes | 10mg |
Reference data compiled from public chemical databases and the peer-reviewed literature. Provided for laboratory research use only.
Research context
Studied in laboratory models for its role in actin regulation, cell migration, and tissue-repair pathways.
Thymosin Beta-4. A 43-amino-acid research compound involved in actin sequestration and tissue repair.
For research use only. Not for human or veterinary use. Sold as a laboratory reference material for in-vitro research.
Certificate of Analysis
Each lot of TB-500 is independently tested by Janoshik Analytical by HPLC (purity) and mass spectrometry (identity), and released against a batch-specific certificate of analysis. Request the COA for your lot number and we'll send the matching certificate so you can verify vial-to-lot before any assay work.
Request this batch's COA →New to COAs? Read our guide on how to read a peptide certificate of analysis.
Frequently asked questions
What is TB-500 studied for?
Studied in laboratory models for its role in actin regulation, cell migration, and tissue-repair pathways.
What is the molecular formula of TB-500?
TB-500 has molecular formula C212H350N56O78S, and a molecular weight of ~4963.4 g/mol, and CAS number 77591-33-4.
How is TB-500 stored and reconstituted?
Soluble in bacteriostatic water / 0.9% NaCl Lyophilized: -20°C, 24+ months. Reconstituted: 2-8°C, use within 4 weeks.
Is TB-500 for human use?
No. TB-500 is supplied strictly as a laboratory reference material for research use only — not for human or veterinary use.
Researcher reviews
No researcher reviews yet for TB-500. Verified reviews from researchers appear here after a completed order.
Related compounds
Researchers also viewed
$42.00 per vial · 10-vial minimum
2 sizes, from $225.00 per pack
BPC-157
Body Protection Compound-157. A 15-amino-acid partial sequence of human gastric juice protein.
$63.00 per vial · 10-vial minimum
BPC-157 + TB-500
A synergistic blend of BPC-157 and TB-500 for advanced tissue-repair and recovery research.
$38.50 per vial · 10-vial minimum
2 sizes, from $385.00 per pack
Epithalon
A synthetic tetrapeptide analogue of epithalamin studied for telomere elongation, anti-aging, and circadian-rhythm regulation.
$35.00 per vial · 10-vial minimum
KPV
A C-terminal tripeptide of α-MSH with potent anti-inflammatory and gut-protective properties.